PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.0697s0095.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family GATA
Protein Properties Length: 323aa    MW: 35757.7 Da    PI: 6.314
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.0697s0095.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.53.9e-18231264134
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                          C +C +tkTp+WR gp g+ktLCnaCG++y++ +
  Bostr.0697s0095.1.p 231 CMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGR 264
                          99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169922.7E-961321IPR016679Transcription factor, GATA, plant
SMARTSM004018.0E-16225275IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.78225261IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.14E-14229288No hitNo description
Gene3DG3DSA:3.30.50.102.4E-14229262IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.60E-15230277No hitNo description
PROSITE patternPS003440231256IPR000679Zinc finger, GATA-type
PfamPF003204.1E-16231264IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009845Biological Processseed germination
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MIGQSFPEDL DCGNFFDNMD DLMDFPGGDI DVGFDIGDSD SFPTIWTTHH DTWPAASDPL  60
FSSNTNSDSS PELYVPFEDI VKVDRPPSFV EESLVEKKED SFSTNTDSSS SHSQFRSSSP  120
VSVLESSSSS SQTTNTTSLV LPAKHGRPRT KRPRPPVQEK DRVKDNVCGA DSRLIIRIPK  180
QFLSDHNKMI NKKKKKKAKV TSSSFSSGTD LEVNGNNVDS YSTEQNPVRK CMHCEVTKTP  240
QWRLGPMGPK TLCNACGVRY KSGRLFPEYR PAASPTFTPA LHSNSHKKVA EMRSKRCSDG  300
SYITEENDLQ ELIPNNAYIG VD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1150154KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4121070.0AF412107.1 Arabidopsis thaliana AT3g54810/F28P10_210 mRNA, complete cds.
GenBankAK3175030.0AK317503.1 Arabidopsis thaliana AT3G54810 mRNA, complete cds, clone: RAFL23-14-K23.
GenBankAY0780290.0AY078029.1 Arabidopsis thaliana AT3g54810/F28P10_210 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002876270.10.0BME3/BME3-ZF
SwissprotQ9SV300.0GATA8_ARATH; GATA transcription factor 8
TrEMBLD7LUX80.0D7LUX8_ARALL; BME3/BME3-ZF
STRINGfgenesh2_kg.5__1883__AT3G54810.20.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49752751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.21e-143GATA family protein